PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS68880.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MIKC_MADS
Protein Properties Length: 205aa    MW: 23514.2 Da    PI: 9.9414
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS68880.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF946.9e-30959151
                S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
      SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                krien s rqvtfskRrng+lKKA+ELSvLCdaev +iifs++g+lye+ss
  EPS68880.1  9 KRIENASSRQVTFSKRRNGLLKKAYELSVLCDAEVGLIIFSQKGRLYEFSS 59
                79***********************************************96 PP

2K-box60.28.7e-2181167995
       K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                  +e+  ++l++e + +  +ie+L+ +q +llG +++s+s+ eLq++ ++Leksl kiRs+K +l++++i +lq+kek l +en++L+
  EPS68880.1  81 EAEQRIQHLKNETSIMAGKIEQLEATQSKLLGRNISSCSMGELQEMDEELEKSLVKIRSTKAQLFKQEILKLQEKEKFLLQENHRLS 167
                 578899******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006632.17161IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-39160IPR002100Transcription factor, MADS-box
CDDcd002657.38E-38271No hitNo description
PRINTSPR004042.3E-31323IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.19E-31385IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.1E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004042.3E-313859IPR002100Transcription factor, MADS-box
PfamPF014869.3E-2084169IPR002487Transcription factor, K-box
PROSITE profilePS5129712.886176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MARGKVQLKR IENASSRQVT FSKRRNGLLK KAYELSVLCD AEVGLIIFSQ KGRLYEFSSC  60
NIQKLIHKYL ERRKEEITGP EAEQRIQHLK NETSIMAGKI EQLEATQSKL LGRNISSCSM  120
GELQEMDEEL EKSLVKIRST KAQLFKQEIL KLQEKEKFLL QENHRLSFKS GMKEKMDQGS  180
CSRSTQGSEV VTELFIGLSM PPKKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S6e-21171171Myocyte-specific enhancer factor 2B
1tqe_R6e-21171171Myocyte-specific enhancer factor 2B
1tqe_Q6e-21171171Myocyte-specific enhancer factor 2B
1tqe_P6e-21171171Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076262.19e-89PREDICTED: MADS-box protein SOC1-like
RefseqXP_011076263.19e-89PREDICTED: MADS-box protein SOC1-like
SwissprotO646457e-67SOC1_ARATH; MADS-box protein SOC1
TrEMBLS8CQ921e-147S8CQ92_9LAMI; Uncharacterized protein
STRINGBra000393.1-P2e-66(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-58AGAMOUS-like 20
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]